PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590777.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 298aa    MW: 34690.1 Da    PI: 9.3564
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590777.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21e-1472117147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v++ G+ +W++Ia++++ gR++k+c++rw++ 
   XP_013590777.1  72 RGHWRPAEDAKLKKLVALDGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 117
                      899*****************************.***********996 PP

2Myb_DNA-binding56.37.2e-18124167146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+++l +a++++G++ W+ Iar ++ gRt++++k++w+ 
   XP_013590777.1 124 RRAFSEEEEQRLMQAHNLYGNK-WAMIARFFP-GRTDNSVKNHWHV 167
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.40467118IPR017930Myb domain
SuperFamilySSF466893.52E-2870165IPR009057Homeodomain-like
SMARTSM007175.3E-1171120IPR001005SANT/Myb domain
PfamPF002492.3E-1472117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2573125IPR009057Homeodomain-like
CDDcd001671.29E-1075116No hitNo description
PROSITE profilePS5129425.781119173IPR017930Myb domain
SMARTSM007171.2E-14123171IPR001005SANT/Myb domain
PfamPF002493.9E-15124166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-21126172IPR009057Homeodomain-like
CDDcd001673.02E-11126166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MSEDHRRWMD QTASCGYFSL DISNYQHSGH SYASHREEEI KDPNQSNYGK RSKKETRVCG  60
SFRHSSKASV VRGHWRPAED AKLKKLVALD GPQNWNLIAE KLQGRSGKSC RLRWFNQLDP  120
RINRRAFSEE EEQRLMQAHN LYGNKWAMIA RFFPGRTDNS VKNHWHVIMA RKFREQSSVY  180
RRRKTVIPLK PLVNPNPQYS CNDFDPSRSD TIHLVSNDKN HLMLPIPCFP GYAHGNESPL  240
MLGMLENQMM VDDDHSARTR EATTFDFLNQ TEKCEMLGEG MNEQKKPHFF DFLGLGTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-31701732105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-306917355159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-306917355159MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-31701732105C-Myb DNA-Binding Domain
1msf_C4e-31701732105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590777.10.0PREDICTED: transcription factor MYB75
TrEMBLA0A0D3CXN20.0A0A0D3CXN2_BRAOL; Uncharacterized protein
STRINGBra003995.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-154myb domain protein 105